PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02996.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 205aa    MW: 22943.8 Da    PI: 10.5078
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02996.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.2e-393392261
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                              +++lkcprC+s+ntkfCyynnyslsqPr+fCkaCrryWt+GGalrnvP+Ggg+rk kks
  Rsa1.0_02996.1_g00001.1 33 DQQTLKCPRCNSSNTKFCYYNNYSLSQPRHFCKACRRYWTRGGALRNVPIGGGCRKTKKS 92
                             57899***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.7E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4973791IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-263791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MSSHTNLHSP KPDHRTTGTS HTKKPPSSSP SQDQQTLKCP RCNSSNTKFC YYNNYSLSQP  60
RHFCKACRRY WTRGGALRNV PIGGGCRKTK KSFKPNSVIT PSSSSSQRFF SSIMEDSTKF  120
FPPPTTMDFQ LAGLSLNKIN DLQLMNNQEV LGLRPMDQVE TTPVDVGSGL SLMGFGRLQQ  180
QQTTTPTTTT IHRERSQPPE QRTVT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892661e-131AC189266.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB022L12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013728157.11e-122PREDICTED: dof zinc finger protein DOF5.7-like
SwissprotQ9LSL62e-99DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A078F2N61e-127A0A078F2N6_BRANA; BnaA06g24490D protein
STRINGBra024399.1-P1e-119(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.13e-84Dof family protein